C1orf198

C1orf198
Identifiers
AliasesC1orf198, chromosome 1 open reading frame 198
External IDsMGI: 1916801; HomoloGene: 13120; GeneCards: C1orf198; OMA:C1orf198 - orthologs
Orthologs
SpeciesHumanMouse
Entrez

84886

69551

Ensembl

ENSG00000119280

ENSMUSG00000031983

UniProt

Q9H425

Q8C3W1

RefSeq (mRNA)

NM_032800
NM_001136494
NM_001136495

NM_175149

RefSeq (protein)

NP_001129966
NP_001129967
NP_116189
NP_116189.1

NP_780358

Location (UCSC)Chr 1: 230.84 – 230.87 MbChr 8: 125.36 – 125.39 Mb
PubMed search[3][4]
Wikidata
View/Edit HumanView/Edit Mouse

Chromosome 1 open reading frame 198 (C1orf198) is a protein that in humans is encoded by the C1orf198 gene.[5] This particular gene does not have any paralogs in Homo sapiens, but many orthologs have been found throughout the Eukarya domain.[6] C1orf198 has high levels of expression in all tissues throughout the human body, but is most highly expressed in lung, brain, and spinal cord tissues. Its function is most likely involved in lung development and hypoxia-associated events in the mitochondria, which are major consumers of oxygen in cells and are severely affected by decreases in available cellular oxygen.

Gene

Location

C1orf198 is a protein-encoding gene found on the reverse strand of chromosome 1 at the locus 1q42. The longest mRNA transcript comprises 3,778 base pairs and spans from 230,837,119 to 230,869,589 on chromosome 1.[7] The span of the gene from the start of transcription to polyA site, including introns, is 32,470 bp. This gene also contains a domain of unknown function called DUF4706. In total, C1orf198 has 4 exons.

The location of C1orf198 on chromosome 1.

Expression

Tissue distribution

RNA-seq tissue data revealed high expression of C1orf198 across all tissues, but especially high expression in lung, heart, spinal cord, and brain tissues.[8] Expression from RNA-seq assays are reported as mean TPM, or transcripts per million, which correspond to mean values of the different individual samples from each tissue. Transcription profiling by high throughput sequencing revealed similar patterns of expression.[9]

Gene expression of C1orf198 in human tissues.

Conditional expression

Comparison of far-upstream element binding protein knockdowns revealed differential expression in C1orf198.[10] Compared to FBP1 and FBP3, FBP2 knockdown had a significant impact on the expression of C1orf198. FBP2 knockdown was associated with a decrease in C1orf198 expression in comparison to cells with regular expression of FBP2.

Regulation

Promoter


A simple diagram of C1orf198, showing the exons, introns, and promoter.

Genomatix predicted several promoters, but the best prediction was of a 1,223 bp long promoter that overlapped with exon 1 of C1orf198 by 82 bp.[11] This promoter, GXP_127773, was conserved in all 15 orthologs found by Genomatix.

Transcription Factor Binding Sites

Many transcription factor (TF) binding sites have been predicted, but a few of the more notable TFs found to bind to a region on C1orf198 are XCPE1, HIF, and USF. XCPE1 is an important transcription factor for poorly categorized TATA-less genes in the human genome, and it drives RNA polymerase II transcription.[12] It is found in the core promoter regions of approximately 1% of human genes.  XCPE1 is located between nucleotides -8 and +2 in relation to the start of transcription (+1).  With a matrix score of 0.83, it containing the correct consensus sequence, and its location on the promoter being correct, the probability of this transcription factor actually binding to this promoter is high.

HIF is a transcription factor that responds to decreases in available oxygen in the cellular environment.[13] It functions as a master regulator of cellular and systemic homeostatic response to hypoxia by activating transcription of many genes.  HIF-1 is known to induce transcription of gene involved in energy metabolism, angiogenesis, apoptosis, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia.

LKLF2 is a transcription factor that has shown high expression in adult mouse lungs and is thought to play a role in lung development.[14] Overexpression of LKLF in lung epithelial cells increases cytosolic phospholipase A2, which has shown to be the cause of tumorigenesis of non-small-cell lung cancer.[15]

E26 transformation-specific (ETS) Proto-oncogene 1 functions as an oncogene and plays a key role in the progression of certain cancer.[16]  Expression of ETS1was increased in cancer tissues as compared with the expression in corresponding non-neoplastic tissues.

Finally, USF is an upstream stimulating factor, which is involved in mediating recruitment of chromatin remodelling enzymes and interacting with co-activators and members of the transcription pre-initiation complex.[17]

Protein

C1orf198’s longest isoform has a sequence length of 327 amino acids.  The entire sequence is as follows:

MASMAAAIAASRSAVMSGNRPLDDRERKRFTYFSSLSPMARKIMQDKEKIREKYGPEWARLPPAQQDEII

DRCLVGPRAPAPRDPGDSEELTRFPGLRGPTGQKVVRFGDEDLTWQDEHSAPFSWETKSQMEFSISALSI

QEPSNGTAASEPRPLSKASQGSQALKSSQGSRSSSLDALGPTRKEEEASFWKINAERSRGEGPEAEFQSL

TPSQIKSMEKGEKVLPPCYRQEPAPKDREAKVERPSTLRQEQRPLPNVSTERERPQPVQAFSSALHEAAP

SQLEGKLPSPDVRQDDGEDTLFSEPKFAQVSSSNVVLKTGFDFLDNW

The entire protein has a theoretical molecular weight of 36.346 kDa and its isoelectric point is 5.6.[18]

Isoforms

Three different isoforms of C1orf198 have been found. The longest isoform contains 327 amino acids and has a molecular mass of 36.3 kDa. The second isoform is 289 amino acids long. The third and last known isoform is 197 amino acids long and also lacks DUF4706.

The amino acid composition of C1orf198.

Amino acid composition

C1orf198 has the highest composition of serine, glutamic acid, proline, alanine, and arginine; It has the lowest composition of histidine.  Relative to the average human protein, C1orf198 is serine-rich, proline-rich, and tyrosine-poor.[19]

Domain

This sequence includes a domain of unknown function, DUF4706, which is approximately 101 amino acids long.  DUF4706 is located from amino acids 31 to 131 on C1orf198. It has a predicted molecular weight of 11.6 kDa and an isoelectric point of 5.41.[20]

Post-translational modifications

The post-translational modifications (PTMs) found in C1orf198 include phosphorylations, SUMOylations, and O-linked β-N-acetylglucosamine (O-GlcNAc) sites. While phosphorylations are the most common PTM and found in all protein types, O-GlcNAc is a regulatory PTM of nuclear and cytosolic proteins.[21]

Subcellular location

C1orf198 is predicted to be targeted towards the cytoplasm, mitochondria, and nucleus.[22] The most highly supported sub cellular location is the cytoplasm, with many bioinformatics tools citing that as the sole location. Both immunohistochemistry and immunofluorescent staining of human cells showed strong cytoplasmic positivity.[23] However, a mitochondrial targeting peptide was predicted in C1orf198, suggesting that its directed towards the mitochondria in some situations.[24]

Interactions

Multiple protein interactions with C1orf198 were found using text mining. One protein interaction involved SART1, which is also known as hypoxia-associated factor. SART1 is known to play a role in mRNA splicing and appears to play a role in hypoxia-induced regulation of EPO gene expression[25] Another protein that interacts with C1orf198 is TOMM20, which is a mitochondrial import receptor subunit. TOMM20 is responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins.[26]

Evolution

Paralogs

There are no known paralogs of C1orf198.[27]

Homologs

As seen in the table below, the homologs for C1orf198 trace back to insects, which diverged from human approximately 797 million years ago.[27]

Species Estimated Date of Divergence from Humans (in MYA).[28] Identity Similarity Amino Acid Sequence Length Reference Sequence
Homo sapiens (Human) 0 100% 100% 327 NP_116189
Delphinapterus leucas(Beluga Whale) 96 81% 86% 317 XP_022408830.1
Hipposideros armiger (Great Roundleaf Bat) 96 79% 85% 317 XP_019521397.1
Erinaceus europaeus (European Hedgehog) 96 76% 82% 333 XP_007538428.1
Phascolarctos cinereus (Koala) 159 65% 76% 333 XP_020856095.1
Parus major (Great Tit) 312 59% 72% 335 XP_015478640.1
Numida meleagris (Helmeted Guineafowl) 312 59% 71% 335 XP_021245723.1
Gallus gallus (Chicken) 312 59% 70% 334 XP_015139870.1
Pogona vitticeps (Bearded Dragon) 312 58% 69% 333 XP_020656857.1
Notechis scutatus (Tiger Snake) 312 57% 69% 333 XP_026525262.1
Gekko japonicus (Japanese Gecko) 312 57% 69% 330 XP_015284731.1
Xenopus tropicalis (Tropical Clawed Frog) 352 47% 68% 350 XP_002942404.1
Monopterus albus (Asian Swamp Eel) 435 42% 56% 360 XP_020471043.1
Anabas testudineus (Climbing Perch) 435 42% 56% 352 XP_026197678.1
Danio rerio (Zebrafish) 435 41% 54% 330 NP_001188382.1
Callorhinchus milii (Elephant Shark) 473 48% 60% 349 XP_007896578.1
Helicoverpa armigera (Cotton Bollworm) 797 28% 40% 284 XP_021198534.1
Copidosoma floridanum (Wasp) 797 25% 41% 297 XP_014207188.1
Chilo suppressalis (Asiatic Rice Borer) 797 24% 40% 280 RVE51599.1

Homologous domains

The domain of unknown function 4706 (DUF4706) was highly conserved in most orthologs.[29]

Function and biochemistry

C1orf198 is most likely involved in lung development and hypoxia-associated events in the mitochondria, which are major consumers of oxygen in cells and are severely affected by decreases in available cellular oxygen.  This is supported by a few major findings.  First, the transcription factor LKLF binds to the promoter, which is involved in embryonic lung development and can cause lung cancer if overexpressed.  The protein product also interacts with SART1, also known as hypoxia associated factor, which appears to play a role in hypoxia-induced regulation of EPO gene expression.

Clinical significance

C1orf198 has been found to be associated with a few diseases and disorders, even though the function of the gene is not yet well understood.  For example, it was identified as a novel gene in colon, gastric, and pancreatic cancer.  Specifically, it was found to be a positive impact factor of gastric cancer.[30]  Additionally, microarray analysis revealed that C1orf198 was a differentially expressed gene (DEG) between lung squamous cell carcinoma (SCC) and normal controls. The down-regulation of C1orf198 was found to be correlated to lung SCC but was not one of the top DEGs found in the study.[31]  A third association was found to be an upregulation of C1orf198 in ginsenoside RH2-treated MCF-7, which is a human breast cancer cell line.  When the cell line was treated with RH2, the C1orf198 gene was found to be hypomethylated, which suggested that its function could be involved in cell-mediated immune responses and cancer-related pathways. The results of this study showed a higher survival rate associated with the up-regulation of C1orf198.[32]

References

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000119280 – Ensembl, May 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000031983 – Ensembl, May 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "C1orf198 chromosome 1 open reading frame 198 [Homo sapiens (human)] - Gene - NCBI". www.ncbi.nlm.nih.gov. Retrieved 2019-02-28.
  6. ^ "Protein BLAST: search protein databases using a protein query". blast.ncbi.nlm.nih.gov. Retrieved 2019-02-28.
  7. ^ "C1orf198 Gene - GeneCards | CA198 Protein | CA198 Antibody". www.genecards.org. Retrieved 2019-02-28.
  8. ^ S. Navani, The human protein atlas. J. Obstet. Gynecol. India. 61(2011), pp. 27–31.
  9. ^ NCBI, NCBI Gene. Gene Cat.(2016), doi:10.1016/B978-0-444-52898-8.00003-3
  10. ^ Barrett T, Wilhite SE, Ledoux P, Evangelista C, Kim IF, Tomashevsky M, Marshall KA, Phillippy KH, Sherman PM, Holko M, Yefanov A, Lee H, Zhang N, Robertson CL, Serova N, Davis S, Soboleva A (January 2013). "NCBI GEO: archive for functional genomics data sets--update". Nucleic Acids Research. 41 (Database issue): D991–5. doi:10.1093/nar/gks1193. PMC 3531084. PMID 23193258.
  11. ^ Cartharius K, Frech K, Grote K, Klocke B, Haltmeier M, Klingenhoff A, Frisch M, Bayerlein M, Werner T (July 2005). "MatInspector and beyond: promoter analysis based on transcription factor binding sites". Bioinformatics. 21 (13): 2933–42. doi:10.1093/bioinformatics/bti473. PMID 15860560.
  12. ^ Tokusumi Y, Ma Y, Song X, Jacobson RH, Takada S (March 2007). "The new core promoter element XCPE1 (X Core Promoter Element 1) directs activator-, mediator-, and TATA-binding protein-dependent but TFIID-independent RNA polymerase II transcription from TATA-less promoters". Molecular and Cellular Biology. 27 (5): 1844–58. doi:10.1128/MCB.01363-06. PMC 1820453. PMID 17210644.
  13. ^ G. L. Semenza, in Cambridge University Press(2007), vol. 9780521853767, pp. 246–255.
  14. ^ M. A. Wani, S. E. Wert, J. B. Lingrel, Lung Kruppel-like factor, a zinc finger transcription factor, is essential for normal lung development. J. Biol. Chem.274, 21180–21185 (1999).
  15. ^ M. J. WICK, S. BLAINE, V. VAN PUTTEN, M. SAAVEDRA, R. A. NEMENOFF, Lung Krüppel-like factor (LKLF) is a transcriptional activator of the cytosolic phospholipase A 2 α promoter . Biochem. J.387, 239–246 (2005).
  16. ^ X. Liu et al., E26 Transformation-Specific Transcription Factor ETS2 as an Oncogene Promotes the Progression of Hypopharyngeal Cancer. Cancer Biother. Radiopharm.32, 327–334 (2017).
  17. ^ Corre S, Galibert MD (October 2005). "Upstream stimulating factors: highly versatile stress-responsive transcription factors". Pigment Cell Research. 18 (5): 337–48. doi:10.1111/j.1600-0749.2005.00262.x. PMID 16162174.
  18. ^ S. Chojnacki, A. Cowley, J. Lee, A. Foix, R. Lopez, Programmatic access to bioinformatics tools from EMBL-EBI update: 2017. Nucleic Acids Res.45, W550–W553 (2017).
  19. ^ B. Rost, J. Liu, The PredictProtein server. Nucleic Acids Res.31, 3300–3304 (2003).
  20. ^ Chojnacki S, Cowley A, Lee J, Foix A, Lopez R (July 2017). "Programmatic access to bioinformatics tools from EMBL-EBI update: 2017". Nucleic Acids Research. 45 (W1): W550–W553. doi:10.1093/nar/gkx273. PMC 5570243. PMID 28431173.
  21. ^ Vaidyanathan K, Durning S, Wells L (2014). "Functional O-GlcNAc modifications: implications in molecular regulation and pathophysiology". Critical Reviews in Biochemistry and Molecular Biology. 49 (2): 140–163. doi:10.3109/10409238.2014.884535. PMC 4912837. PMID 24524620.
  22. ^ K. Nakai, P. Horton, PSORT: A program for detecting sorting signals in proteins and predicting their subcellular localization. Trends Biochem. Sci.24(1999), pp. 34–35.
  23. ^ SIGMA-ALDRICH. Anal. Chem.65, 868A–868A (2012).
  24. ^ Emanuelsson O, Nielsen H, Brunak S, von Heijne G (July 2000). "Predicting subcellular localization of proteins based on their N-terminal amino acid sequence". Journal of Molecular Biology. 300 (4): 1005–16. doi:10.1006/jmbi.2000.3903. PMID 10891285.
  25. ^ Calderone A, Castagnoli L, Cesareni G (August 2013). "mentha: a resource for browsing integrated protein-interaction networks". Nature Methods. 10 (8): 690–1. doi:10.1038/nmeth.2561. PMID 23900247. S2CID 9733108.
  26. ^ Orchard S, Ammari M, Aranda B, Breuza L, Briganti L, Broackes-Carter F, Campbell NH, Chavali G, Chen C, del-Toro N, Duesbury M, Dumousseau M, Galeota E, Hinz U, Iannuccelli M, Jagannathan S, Jimenez R, Khadake J, Lagreid A, Licata L, Lovering RC, Meldal B, Melidoni AN, Milagros M, Peluso D, Perfetto L, Porras P, Raghunath A, Ricard-Blum S, Roechert B, Stutz A, Tognolli M, van Roey K, Cesareni G, Hermjakob H (January 2014). "The MIntAct project--IntAct as a common curation platform for 11 molecular interaction databases". Nucleic Acids Research. 42 (Database issue): D358–63. doi:10.1093/nar/gkt1115. PMC 3965093. PMID 24234451.
  27. ^ a b BLAST, Nucleotide BLAST: Search nucleotide databases using a nucleotide query. Basic Local Alignment Search Tool(2009), (available at https://blast.ncbi.nlm.nih.gov/Blast.cgi ).
  28. ^ Morrison DA (August 2009). "The Timetree of Life". Systematic Biology. 58 (4): 461–2. doi:10.1093/sysbio/syp042.
  29. ^ Larkin MA, Blackshields G, Brown NP, Chenna R, McGettigan PA, McWilliam H, Valentin F, Wallace IM, Wilm A, Lopez R, Thompson JD, Gibson TJ, Higgins DG (November 2007). "Clustal W and Clustal X version 2.0". Bioinformatics. 23 (21): 2947–8. doi:10.1093/bioinformatics/btm404. PMID 17846036.
  30. ^ Wang Z, Chen G, Wang Q, Lu W, Xu M (September 2017). "Identification and validation of a prognostic 9-genes expression signature for gastric cancer". Oncotarget. 8 (43): 73826–73836. doi:10.18632/oncotarget.17764. PMC 5650304. PMID 29088749.
  31. ^ Zhang F, Chen X, Wei K, Liu D, Xu X, Zhang X, Shi H (January 2017). "Identification of Key Transcription Factors Associated with Lung Squamous Cell Carcinoma". Medical Science Monitor. 23: 172–206. doi:10.12659/MSM.898297. PMC 5248564. PMID 28081052.
  32. ^ Lee H, Lee S, Jeong D, Kim SJ (October 2018). "Ginsenoside Rh2 epigenetically regulates cell-mediated immune pathway to inhibit proliferation of MCF-7 breast cancer cells". Journal of Ginseng Research. 42 (4): 455–462. doi:10.1016/j.jgr.2017.05.003. PMC 6187096. PMID 30337805.